PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10008010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 437aa    MW: 48740.2 Da    PI: 9.6395
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10008010genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-153680146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +grWT++Ed ll++ v+++ g++W++Ia++++ gR+  qc  rw  
      Lus10008010 36 KGRWTQDEDHLLIKSVHKFQGKRWRKIAECLP-GRSVSQCFYRWSR 80
                     79******************************.***********76 PP

2Myb_DNA-binding543.8e-1788134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd+ + ++v+++G ++W+ Ia+ ++ gR +kqc++rw+++l
      Lus10008010  88 KGTWTKEEDDCIRELVRMHGLRRWSVIASFLP-GRLGKQCRERWHNHL 134
                      799*****************************.*************97 PP

3Myb_DNA-binding47.73.5e-15141183246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g WT+eE+ +l  +++ +G++ W++ ar+++ gR+++ +k++w+ 
      Lus10008010 141 GCWTEEEERILTFYHEIYGNK-WAALARYLP-GRSDNAIKNHWNC 183
                      78*******************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.4173182IPR017930Myb domain
SuperFamilySSF466891.0E-143489IPR009057Homeodomain-like
SMARTSM007171.8E-143584IPR001005SANT/Myb domain
PfamPF002491.0E-133680IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-203794IPR009057Homeodomain-like
CDDcd001671.49E-123882No hitNo description
PROSITE profilePS5129428.42483138IPR017930Myb domain
SuperFamilySSF466895.62E-3086181IPR009057Homeodomain-like
SMARTSM007178.3E-1787136IPR001005SANT/Myb domain
PfamPF002497.6E-1788134IPR001005SANT/Myb domain
CDDcd001678.59E-1590134No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2695140IPR009057Homeodomain-like
SMARTSM007176.6E-14139187IPR001005SANT/Myb domain
PROSITE profilePS5129416.749139189IPR017930Myb domain
PfamPF002496.2E-13141182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-19141189IPR009057Homeodomain-like
CDDcd001672.07E-11143185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MDVLPFSVYL DSRSIIIPNT VSFQSRATGP TRHSGKGRWT QDEDHLLIKS VHKFQGKRWR  60
KIAECLPGRS VSQCFYRWSR VLNPAIYKGT WTKEEDDCIR ELVRMHGLRR WSVIASFLPG  120
RLGKQCRERW HNHLDPGIKE GCWTEEEERI LTFYHEIYGN KWAALARYLP GRSDNAIKNH  180
WNCVKKNKLQ TMSAANGRAV DQPTCACMEQ GQSLDGTCSL IEAKTTNVID VGSRELLTLD  240
LKLQCHVSAP KSPCHPEAES PGIPRQRKVL GVLNQNIIEG TPFLHSLSSD TFSKHNGKTT  300
RGNNVQKDCT AVGSPNKDDH HLLGQSVAWS TPGSLVLSCK GYNSAESILR NSAKTFRNIP  360
AIIRKRSSRT RTVRADCISE GSILHSGQQG FLYKSYPSVA IQSLRRNLND AFDSESATVA  420
ASEANNNSVP ASINSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-55331893159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-55331893159MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133012528
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-73myb domain protein 3r-5